General Information

  • ID:  hor004559
  • Uniprot ID:  E1ZZF9
  • Protein name:  FMRFamide 3
  • Gene name:  EAG_11727
  • Organism:  Camponotus floridanus (Florida carpenter ant)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Expressed throughout the central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camponotus (genus), Camponotini (tribe), Formicinae (subfamily), Formicidae (family), Formicoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GKNDLNFIRF
  • Length:  10
  • Propeptide:  MLVSSSVLKDDSSLRIFKESPNEFEYIIKRHDMDDRKEDTESKERRSTMGSSFIRFGRGQSFFNNLDNSAFDNEIDSKVSRHPRWKSPDIVIRFGRSGMKSTNDEQPKRGKNDLNFIRFGRNIQIVPTDFDLSAVCSALMSNDAISDAGLHPDVTRLFRLCNNLNKITGEISLDSLETNSNHRE
  • Signal peptide:  NA
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have modulatory actions at skeletal neuromuscular junctions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E1ZZF9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004559_AF2.pdbhor004559_ESM.pdb

Physical Information

Mass: 138411 Formula: C56H86N16O15
Absent amino acids: ACEHMPQSTVWY Common amino acids: FN
pI: 9.69 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -54 Boman Index: -2573
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: -1452 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25641051
  • Title:  Neuropeptidomics of the carpenter ant Camponotus floridanus.